PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g019550.1
Common NameMTR_5g019550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family BES1
Protein Properties Length: 324aa    MW: 35290.6 Da    PI: 9.7957
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g019550.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822201.32.9e-6251501147
           DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspessl 94 
                      g+sgr ptwkErEnnkrRERrRRaiaakiy+GLRaqGn+klpk++DnneVlkALc eAGw+ve+DGttyrkgsk++  +e++g+ +++s +ss+
  Medtr5g019550.1   5 GSSGRLPTWKERENNKRRERRRRAIAAKIYSGLRAQGNFKLPKHCDNNEVLKALCSEAGWIVEEDGTTYRKGSKRPLPNEMGGTPTNMSACSSM 98 
                      689*************************************************************************9***************** PP

           DUF822  95 qsslkssalaspvesysaspksssfpspssldsislasaasllpvlsvlslvs 147
                      q s++ss+++sp +s+ +sp  s   sp+++d i++ s + llp++++ ++++
  Medtr5g019550.1  99 QPSPQSSSFPSPQSSSFPSPIPSYPTSPTRMDGITNPS-SFLLPFIRNITSIP 150
                      **********************************8874.77888888776654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056873.0E-586136IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009741Biological Processresponse to brassinosteroid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MTGGGSSGRL PTWKERENNK RRERRRRAIA AKIYSGLRAQ GNFKLPKHCD NNEVLKALCS  60
EAGWIVEEDG TTYRKGSKRP LPNEMGGTPT NMSACSSMQP SPQSSSFPSP QSSSFPSPIP  120
SYPTSPTRMD GITNPSSFLL PFIRNITSIP TNLPPLRISN SAPVTPPLSS PRSSKRKADF  180
ESLCNGSFNS SFRHPLFATS APSSPSRRNH LPPSTIPECD ESDASTVDSG RWVSFQTTTA  240
HGAAPPSPTF NLMKPAMQIT PQSSMDMKHM NEAMQWSAGS ATERGRGSDF DFENGRVVKP  300
WEGERIHEVG MEELELTLGF GKA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.90380.0flower| glandular trichome| leaf| pod| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1437940.0BT143794.1 Medicago truncatula clone JCVI-FLMt-9I5 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003611934.10.0brassinazole-resistant 1 protein
SwissprotQ94A431e-102BEH2_ARATH; BES1/BZR1 homolog protein 2
TrEMBLG7KC600.0G7KC60_MEDTR; Brassinazole-resistant 1 protein
STRINGGLYMA11G06865.11e-136(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127534105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.21e-76BES1 family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]